Structure of PDB 8afd Chain C

Receptor sequence

>8afdC (length=161) Species: 9606 (Homo sapiens)

GMTEYKLVVVGAVGVGKSALTIQLIQNHFVDEYDPTIEDCYRKQVVIDGE
TCLLDILDTAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDS
EDVPMVLVGNKSDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAF
YTLVREIRKHK

3D structure

• PDB: 8afd Fragment Optimization of Reversible Binding to the Switch II Pocket on KRAS Leads to a Potent, In Vivo Active KRAS G12C Inhibitor.
• Chain: C
• Resolution: 1.633 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.2: small monomeric GTPase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GDP	C	G13 V14 G15 K16 S17 A18 F28 D30 N116 K117 D119 L120 S145 A146	G14 V15 G16 K17 S18 A19 F29 D31 N110 K111 D113 L114 S139 A140
BS02	2XO	C	L6 V7 C39 D54 L56 Y71 G75	L7 V8 C40 D55 L57 Y65 G69
BS03	2XO	C	K88 E91	K82 E85

Gene Ontology

Molecular Function

• GO:0003924 GTPase activity
• GO:0005525 GTP binding

Biological Process

• GO:0007165 signal transduction

Cellular Component

• GO:0016020 membrane

External links

• PDB: RCSB:8afd, PDBe:8afd, PDBj:8afd
• PDBsum: 8afd
• PubMed: 36300829
• UniProt: P01116|RASK_HUMAN GTPase KRas (Gene Name=KRAS)