Structure of PDB 8aca Chain C |
>8acaC (length=120) Species: 243230 (Deinococcus radiodurans R1 = ATCC 13939 = DSM 20539) [Search protein sequence] |
GPTEGTYTLAPQAVVKPAGPVYAPAGTAKISETLGVTRTTITLTGMAPYA IYVAHYHKMGSDGPAIMESRMIAQASADGKVTLTGIVPTALIRDAAYINV HHGRDFSGALADSGVICTPI |
|
PDB | 8aca The SDBC is active in quenching oxidative conditions and bridges the cell envelope layers in Deinococcus radiodurans. |
Chain | C |
Resolution | 2.54 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
C |
H74 H76 H182 |
H55 H57 H101 |
|
|
|