Structure of PDB 8abj Chain C

Receptor sequence

>8abjC (length=383) Species: 4952 (Yarrowia lipolytica)

MALRKKNSLLNMANSYVLDSPQPSNLNYFWNFGSLLALCLVIQLATGITL
AMHYTSHASLAFDSVEHIMRDVNFGWFIRYAHANTASFFFICIYAHMGRN
IYYGSYKTPRVLPWSIGVIIFLLLIITAFMGYVLVFGQMSLWGATVICNL
VSAIPWLGEDIVHFLWGGFSVGNPTLQRFFALHYLMPFVLAVFALLHLIA
LHTAGSSNPLGITSNVDKLSMHPYYSFKDLITVFAFLLMFTLFVFFSPDK
LGHPDNYIPANPMVTPASIVPEWYLLPFYAILRAIPDKLGGVIAMVAAIL
ILLILPIVDRSIIRGNAFKPISKLLFGFFICNFLLLGVLGQVHIEPPFIV
LGQICTIFYFSYFLILLPMVSTIENIFFYIGSL

3D structure

• PDB: 8abj Analysis of the conformational heterogeneity of the Rieske iron-sulfur protein in complex III 2 by cryo-EM.
• Chain: C
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	Q43 G47 L50 R79 H82 T127 G131 Y132 L134 V135 H183 Y184 P187	Q43 G47 L50 R79 H82 T127 G131 Y132 L134 V135 H183 Y184 P187
BS02	HEM	C	W30 G33 L36 H96 R99 N100 S105 W114 G117 I120 H197 L198 L201 S206 S207	W30 G33 L36 H96 R99 N100 S105 W114 G117 I120 H197 L198 L201 S206 S207
BS03	AWB	C	V17 Q22 W30 N31 A37 L195 L198 M221 Y225 D229	V17 Q22 W30 N31 A37 L195 L198 M221 Y225 D229

Gene Ontology

Molecular Function

• GO:0008121 ubiquinol-cytochrome-c reductase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0022904 respiratory electron transport chain
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0045275 respiratory chain complex III

External links

• PDB: RCSB:8abj, PDBe:8abj, PDBj:8abj
• PDBsum: 8abj
• PubMed: 36598500
• UniProt: Q9B6D0|CYB_YARLI Cytochrome b (Gene Name=COB)