Structure of PDB 8a1q Chain C |
>8a1qC (length=58) Species: 11676 (Human immunodeficiency virus 1) [Search protein sequence] |
NFRVYYRDSRDPVWKGPAKLLEKGEGAVVIQDNSDIKVVPRRKAKIIRDY GKQMAGDD |
|
PDB | 8a1q The Drug-Induced Interface That Drives HIV-1 Integrase Hypermultimerization and Loss of Function. |
Chain | C |
Resolution | 2.06 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
WBV |
C |
W235 K266 |
W14 K45 |
|
|
|
|