Structure of PDB 7zxy Chain C

Receptor sequence

>7zxyC (length=279) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]

YPFWAQETAPLTPREATGRIVCANCHLAQKAAEVEIPQAVLPDTVFEAVV
KIPYDLDSQQVLGDGSKGGLNVGAVLMLPEGFKIAPPDRLSEGLKEKVGG
TYFQPYREDMENVVIVGPLPGEQYQEIVFPVLSPDPAKDKSINYGKFAVH
LGANRGRGQIYPTGLLSNNNAFKAPNAGTISEVNALEAGGYQLIGTETVD
IPAGPELIVSAGQTVEAGEFLTNNPNVGGFGQKDTEVVLQNPTRIKFLVL
FLAGIMLSQILLVLKKKQIEKVQAAELNF

3D structure

PDB

7zxy Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.

Chain

Resolution

3.15 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	Q38 A39 L41 P248 I251 K252 V255 L258 M262 Q265 I266 V269 K272 K273	Q38 A39 L41 P242 I245 K246 V249 L252 M256 Q259 I260 V263 K266 K267
BS02	HEC	C	Y1 P2 W4 C22 C25 H26 Q60 N71 V72 G73 P118 N154 G156 R157 G158 I160 Y161 P162	Y1 P2 W4 C22 C25 H26 Q60 N71 V72 G73 P118 N154 G156 R157 G158 I160 Y161 P162

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009512	cytochrome b6f complex
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7zxy, PDBe:7zxy, PDBj:7zxy
PDBsum	7zxy
PubMed	35726684
UniProt	P26287\|CYF_SYNY3 Cytochrome f (Gene Name=petA)

[Back to BioLiP]