Structure of PDB 7zpk Chain C

Receptor sequence
>7zpkC (length=233) Species: 10090 (Mus musculus) [Search protein sequence]
LPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQPNFTFR
VTVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSSECNPVGALQELVVQK
GWRLPEYMVTQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKM
LLRVHTVPSACCSVLSELSEEQAFHVSYLDIEELSLSGLCQCLVELSTQP
ATVCYGSATTREAARGDAAHRALQYLRIMAGSK
3D structure
PDB7zpk Structural and functional basis of mammalian microRNA biogenesis by Dicer.
ChainC
Resolution3.81 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C K29 I32 S33 Q36 A57 P60 K80 K81 K209 K14 I17 S18 Q21 A42 P45 K65 K66 K139
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003725 double-stranded RNA binding
GO:0005515 protein binding
GO:0035197 siRNA binding
GO:0035198 miRNA binding
GO:0042803 protein homodimerization activity
GO:0070883 pre-miRNA binding
Biological Process
GO:0006417 regulation of translation
GO:0007286 spermatid development
GO:0007338 single fertilization
GO:0030422 siRNA processing
GO:0031047 regulatory ncRNA-mediated gene silencing
GO:0031054 pre-miRNA processing
GO:0035196 miRNA processing
GO:0035264 multicellular organism growth
GO:0043403 skeletal muscle tissue regeneration
GO:0045070 positive regulation of viral genome replication
GO:0045727 positive regulation of translation
GO:0046782 regulation of viral transcription
GO:0050689 negative regulation of defense response to virus by host
GO:0051149 positive regulation of muscle cell differentiation
GO:0061351 neural precursor cell proliferation
GO:0070921 regulation of siRNA processing
GO:0070922 RISC complex assembly
GO:0098795 global gene silencing by mRNA cleavage
GO:1903798 regulation of miRNA processing
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0016442 RISC complex
GO:0048471 perinuclear region of cytoplasm
GO:0070578 RISC-loading complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zpk, PDBe:7zpk, PDBj:7zpk
PDBsum7zpk
PubMed36332606
UniProtP97473|TRBP2_MOUSE RISC-loading complex subunit TARBP2 (Gene Name=Tarbp2)

[Back to BioLiP]