Structure of PDB 7znw Chain C

Receptor sequence
>7znwC (length=235) Species: 182057 (Marasmius rotula) [Search protein sequence]
VDFSQHPWKAPGPNDLRSPCPGLNTLANHGFLPRNGRNITIPMIVQAGFD
GYNVQPDILILAAKVGLLTSPEPDTFTLDDLKLHGTIEHDASLSREDFAL
GDNLHFNEAIFNTLANSNPGSDVYNITSAGQVLKDRLADSLARNPNVTNT
GKEFTIRTLESAFYLSVMGNATTGEAPKNFVQIFFREERLPIEEGWKRST
TPITSDTLNPIAGQISEASNWKPNPDQCPWIVLSP
3D structure
PDB7znw Comparing the Catalytic and Structural Characteristics of a 'Short' Unspecific Peroxygenase (UPO) Expressed in Pichia pastoris and Escherichia coli.
ChainC
Resolution2.09 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM C C24 P25 G26 L27 A66 I91 E92 H93 S96 L97 S98 E164 F167 C20 P21 G22 L23 A62 I87 E88 H89 S92 L93 S94 E160 F163
BS02 MG C E92 H93 S96 E88 H89 S92
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Dec 3 00:04:10 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7znw', asym_id = 'C', title = 'Comparing the Catalytic and Structural Character...pressed in Pichia pastoris and Escherichia coli. '
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7znw', asym_id='C', title='Comparing the Catalytic and Structural Character...pressed in Pichia pastoris and Escherichia coli. ')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0004601', uniprot = '', pdbid = '7znw', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0004601', uniprot='', pdbid='7znw', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>