Structure of PDB 7zgl Chain C

Receptor sequence

>7zglC (length=409) Species: 83332 (Mycobacterium tuberculosis H37Rv)

SPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDG
GFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLN
MDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVE
QVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSA
ELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVA
GNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQR
TALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVG
FGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGI
KHWQVDYTG

3D structure

• PDB: 7zgl Crystal structure of CYP125 from Mycobacterium tuberculosis in complex with an inhibitor
• Chain: C
• Resolution: 2.5 Å

Enzymatic activity

• Enzyme Commision number: 1.14.15.29: cholest-4-en-3-one 26-monooxygenase [(25S)-3-oxocholest-4-en-26-oate forming].

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	EIQ	C	I97 Q112 V115 L117 M200 V267 A268 T272 W414	I79 Q94 V97 L99 M182 V249 A250 T254 W396
BS02	HEM	C	M116 H124 R128 F135 L265 A268 G269 T272 P312 F316 R318 G368 F369 G370 H375 C377 A383	M98 H106 R110 F117 L247 A250 G251 T254 P294 F298 R300 G350 F351 G352 H357 C359 A365

Gene Ontology

Molecular Function

• GO:0004497 monooxygenase activity
• GO:0005506 iron ion binding
• GO:0008395 steroid hydroxylase activity
• GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
• GO:0020037 heme binding
• GO:0036199 cholest-4-en-3-one 26-monooxygenase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006707 cholesterol catabolic process
• GO:0008203 cholesterol metabolic process
• GO:0016042 lipid catabolic process
• GO:0051701 biological process involved in interaction with host

External links

• PDB: RCSB:7zgl, PDBe:7zgl, PDBj:7zgl
• PDBsum: 7zgl
• UniProt: P9WPP1|CP125_MYCTU Steroid C26-monooxygenase (Gene Name=cyp125)