Structure of PDB 7yxm Chain C |
>7yxmC (length=133) Species: 269799 (Geobacter metallireducens GS-15) [Search protein sequence] |
KEPDITFFHPDILEVPKDGGLPYLKGYRCKKCGQLDFKTEMCTNCWSEEF EMVPLSRRGKVYSFSDIYIGQQGLATPYIFAYVDLPENLRVFAQLEGEVD TYRCDEEVELTLGPIRMNNDNLPIISYKFKKIA |
|
PDB | 7yxm Finis tolueni: a new type of thiolase with an integrated Zn-finger subunit catalyzes the final step of anaerobic toluene metabolism. |
Chain | C |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
C42 C45 C55 C58 |
C29 C32 C42 C45 |
|
|
|
|