Structure of PDB 7yr7 Chain C

Receptor sequence

>7yr7C (length=55) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]

MLILTRRVGETLMVGDDVTVTVLGVKGNQVRIGVNAPKEVAVHREEIYQR
IQKEK

3D structure

PDB

7yr7 Structural basis of sRNA RsmZ regulation of Pseudomonas aeruginosa virulence.

Chain

Resolution

3.8 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	M1 L2 I3 L4 T5 K38 H43 R44 Y48	M1 L2 I3 L4 T5 K38 H43 R44 Y48

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0048027	mRNA 5'-UTR binding

	Biological Process
GO:0006109	regulation of carbohydrate metabolic process
GO:0006402	mRNA catabolic process
GO:0006417	regulation of translation
GO:0009372	quorum sensing
GO:0030254	protein secretion by the type III secretion system
GO:0033103	protein secretion by the type VI secretion system
GO:0043455	regulation of secondary metabolic process
GO:0045947	negative regulation of translational initiation
GO:0045948	positive regulation of translational initiation
GO:1900190	regulation of single-species biofilm formation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol

External links

PDB	RCSB:7yr7, PDBe:7yr7, PDBj:7yr7
PDBsum	7yr7
PubMed	36828938
UniProt	O69078\|CSRA_PSEAE Translational regulator CsrA (Gene Name=csrA)