Structure of PDB 7ydw Chain C |
>7ydwC (length=92) Species: 10090 (Mus musculus) [Search protein sequence] |
RAVTLRVLLKDELLEPGEGVLSIYYLGRKFTGDLQLDGRIVWQETGQVFN SPSAWATHCKKLVNPAKKSGWASVKYKGQKLDKYKAAWLRRH |
|
PDB | 7ydw Structures of MPND Reveal the Molecular Recognition of Nucleosomes. |
Chain | C |
Resolution | 2.47 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
C |
S113 S115 W135 |
S51 S53 W71 |
|
|
|