Structure of PDB 7y5z Chain C

Receptor sequence
>7y5zC (length=243) Species: 9606 (Homo sapiens) [Search protein sequence]
GAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASV
VWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGL
ASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHG
DSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTS
GLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLL
3D structure
PDB7y5z Molecular basis for isoform-selective inhibition of presenilin-1 by MRK-560.
ChainC
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CLR C G202 F205 L206 G201 F204 L205
BS02 CLR C W188 S223 W227 W187 S222 W226
BS03 CLR C Y210 L214 Y209 L213
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0030674 protein-macromolecule adaptor activity
GO:0061133 endopeptidase activator activity
Biological Process
GO:0001656 metanephros development
GO:0006509 membrane protein ectodomain proteolysis
GO:0007219 Notch signaling pathway
GO:0007220 Notch receptor processing
GO:0010950 positive regulation of endopeptidase activity
GO:0016485 protein processing
GO:0031293 membrane protein intracellular domain proteolysis
GO:0034205 amyloid-beta formation
GO:0042982 amyloid precursor protein metabolic process
GO:0042987 amyloid precursor protein catabolic process
GO:0043085 positive regulation of catalytic activity
Cellular Component
GO:0000139 Golgi membrane
GO:0005769 early endosome
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0008021 synaptic vesicle
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0032580 Golgi cisterna membrane
GO:0042734 presynaptic membrane
GO:0070765 gamma-secretase complex
GO:0097060 synaptic membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7y5z, PDBe:7y5z, PDBj:7y5z
PDBsum7y5z
PubMed36272978
UniProtQ96BI3|APH1A_HUMAN Gamma-secretase subunit APH-1A (Gene Name=APH1A)

[Back to BioLiP]