Structure of PDB 7xx1 Chain C |
>7xx1C (length=125) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search protein sequence] |
TASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGD GKMKDLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGT RNPANNAAIVLQLPQGTTLPKGFYA |
|
PDB | 7xx1 Antiviral drug design based on structural insights into the N-terminal domain and C-terminal domain of the SARS-CoV-2 nucleocapsid protein. |
Chain | C |
Resolution | 1.9 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
D82 H145 |
D34 H97 |
|
|
|
|