Structure of PDB 7xvn Chain C

Receptor sequence
>7xvnC (length=81) Species: 10090 (Mus musculus) [Search protein sequence]
EVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCAYSCTRQQNCPIDRT
SRNRCQHCRLQKCLALGMSRDAVKFGRMSKK
3D structure
PDB7xvn Structural basis for DNA recognition feature of retinoid-related orphan receptors
ChainC
Resolution2.302 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C E49 G50 R57 R80 N81 R87 F103 G104 M106 S107 E23 G24 R31 R52 N53 R59 F75 G76 M78 S79
BS02 dna C G40 I41 Y43 K52 R56 V101 K102 F103 R105 G14 I15 Y17 K26 R30 V73 K74 F75 R77
BS03 ZN C C31 C34 C48 C51 C5 C8 C22 C25
BS04 ZN C C73 C83 C86 C45 C55 C58
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7xvn, PDBe:7xvn, PDBj:7xvn
PDBsum7xvn
PubMed38309263
UniProtP51450|RORG_MOUSE Nuclear receptor ROR-gamma (Gene Name=Rorc)

[Back to BioLiP]