Structure of PDB 7xr4 Chain C

Receptor sequence

>7xr4C (length=425) Species: 9606 (Homo sapiens) [Search protein sequence]

LCDKLGKNLLLTLTVFGVILGAVCGGLLRLASPIHPDVVMLIAFPGDILM
RMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGV
ILVLAIHPGNPKVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVVIKK
GLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVI
MIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFL
PLIYFVVTRKNPFSFFAGIFQAWITALGTASSAGTLPVTFRCLEENLGID
KRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVLDGGQIVTVSLTA
TLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVN
VVGDSFGAGIVYHLSKSELDTIDSQ

3D structure

PDB

7xr4 Structural basis of ligand binding modes of human EAAT2.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GLU	C	S364 M398 T401 S441 G446 D475 R478 T479 N482	S282 M316 T319 S359 G364 D393 R396 T397 N400
BS02	Y01	C	R115 I335	R79 I253

Gene Ontology

	Molecular Function
GO:0005313	L-glutamate transmembrane transporter activity
GO:0005314	high-affinity L-glutamate transmembrane transporter activity
GO:0005515	protein binding
GO:0008509	monoatomic anion transmembrane transporter activity
GO:0015175	neutral L-amino acid transmembrane transporter activity
GO:0015179	L-amino acid transmembrane transporter activity
GO:0015293	symporter activity
GO:0015501	glutamate:sodium symporter activity
GO:0033229	cysteine transmembrane transporter activity
GO:0046872	metal ion binding

	Biological Process
GO:0006750	glutathione biosynthetic process
GO:0006811	monoatomic ion transport
GO:0006836	neurotransmitter transport
GO:0006865	amino acid transport
GO:0007268	chemical synaptic transmission
GO:0007399	nervous system development
GO:0007632	visual behavior
GO:0009410	response to xenobiotic stimulus
GO:0009416	response to light stimulus
GO:0009611	response to wounding
GO:0015804	neutral amino acid transport
GO:0015813	L-glutamate transmembrane transport
GO:0021537	telencephalon development
GO:0030534	adult behavior
GO:0035264	multicellular organism growth
GO:0043200	response to amino acid
GO:0046326	positive regulation of D-glucose import
GO:0070207	protein homotrimerization
GO:0070633	transepithelial transport
GO:0070778	L-aspartate transmembrane transport
GO:0070779	D-aspartate import across plasma membrane
GO:0071314	cellular response to cocaine
GO:0098656	monoatomic anion transmembrane transport
GO:0098712	L-glutamate import across plasma membrane
GO:0098810	neurotransmitter reuptake
GO:0140009	L-aspartate import across plasma membrane
GO:0150104	transport across blood-brain barrier
GO:1903712	cysteine transmembrane transport

	Cellular Component
GO:0005886	plasma membrane
GO:0009986	cell surface
GO:0016020	membrane
GO:0030424	axon
GO:0030673	axolemma
GO:0031982	vesicle
GO:0042734	presynaptic membrane
GO:0044297	cell body
GO:0044306	neuron projection terminus
GO:0045121	membrane raft
GO:0045202	synapse
GO:0097449	astrocyte projection
GO:0098796	membrane protein complex
GO:0098978	glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7xr4, PDBe:7xr4, PDBj:7xr4
PDBsum	7xr4
PubMed	35680945
UniProt	P43004\|EAA2_HUMAN Excitatory amino acid transporter 2 (Gene Name=SLC1A2)

[Back to BioLiP]