Structure of PDB 7xm0 Chain C

Receptor sequence

>7xm0C (length=249) Species: 1280 (Staphylococcus aureus)

SIEDIVFEKFQPYINWSIDKLCEHFSINKGEKGLNYRIASAILNLKGKTT
KSKPFPEVEEFEKSSIVVKTVHFNKKNVNKESMSFGAFKFEELANEEWEP
SAQWRNFLLETRFLFFVVKEDEDGVDIFKGIKFFSMPEEDINGPVKRMWD
DTVKKLKEGVTLEAVPDKSTKDGWRIKNNFVDKSDDLICHVRPHTNNRDY
RGGSNADKLPKKINWINRPDSDDYSDEWMTKQSFWINNDYIKKQVEDLL

3D structure

• PDB: 7xm0 The Self-Activation Mechanism of Type IIE Restriction Endonuclease Sau3AI
• Chain: C
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 3.1.21.4: type II site-specific deoxyribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	E266 R415 I416 K417 N418 D422 K423 S424 R432 P433 H434 T435 N436 N437 R438	E31 R175 I176 K177 N178 D182 K183 S184 R192 P193 H194 T195 N196 N197 R198
BS02	dna	C	K267 Y271 K304 T305 E316 S319 D407 S409 H434 N436 S444 K471 W475	K32 Y36 K69 T70 E81 S84 D167 S169 H194 N196 S204 K231 W235
BS03	MG	C	N418 F420 D422	N178 F180 D182

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0004519 endonuclease activity

External links

• PDB: RCSB:7xm0, PDBe:7xm0, PDBj:7xm0
• PDBsum: 7xm0
• UniProt: P16667|T2S3_STAAU Type II restriction enzyme Sau3AI (Gene Name=sau3AIR)