Structure of PDB 7xgj Chain C

Receptor sequence

>7xgjC (length=166) Species: 9606 (Homo sapiens)

YNFFPRKPKWDKNQITYRIIGYTPDLAPETVDDAFARAFQVWSDVTPLRF
SRIYDGEADIMINFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDD
DELWTLGKGVGYSLFLVAAHAFGHAMGLEHSQDPGALMAPIYTYTKNFRL
SQDDIKGIQELYGASP

3D structure

• PDB: 7xgj Discovery of Aryloxyphenyl-Heptapeptide Hybrids as Potent and Selective Matrix Metalloproteinase-2 Inhibitors for the Treatment of Idiopathic Pulmonary Fibrosis.
• Chain: C
• Resolution: 2.8 Å

Enzymatic activity

• Enzyme Commision number: 3.4.24.24: gelatinase A.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	F5 Y74 G81 L82 L83 A84 H85 A86 F87 A88 V118 H121 H125 H131 L138 A140	F4 Y73 G80 L81 L82 A83 H84 A85 F86 A87 V117 H120 H124 H130 L137 A139
BS02	ZN	C	H121 H125 H131	H120 H124 H130
BS03	ZN	C	H70 D72 H85 H98	H69 D71 H84 H97
BS04	CA	C	D77 G78 K79 D80 L82 D100 E103	D76 G77 K78 D79 L81 D99 E102
BS05	CA	C	D60 G92 V93 G94 D96	D59 G91 V92 G93 D95

Gene Ontology

Molecular Function

• GO:0004222 metalloendopeptidase activity
• GO:0008237 metallopeptidase activity
• GO:0008270 zinc ion binding

Biological Process

• GO:0006508 proteolysis

Cellular Component

• GO:0031012 extracellular matrix

External links

• PDB: RCSB:7xgj, PDBe:7xgj, PDBj:7xgj
• PDBsum: 7xgj
• PubMed: 35687819
• UniProt: P08253|MMP2_HUMAN 72 kDa type IV collagenase (Gene Name=MMP2)