Structure of PDB 7xfy Chain C |
>7xfyC (length=166) Species: 9838 (Camelus dromedarius) [Search protein sequence] |
CGSIVPRREWRALASECRERLTRPVRYVVVSHTAGSHCDTPASCAQQAQN VQSYHVRNLGWCDVGYNFLIGEDGLVYEGRGWNIKGAHAGPTWNPISIGI SFMGNYMNRVPPPRALRAAQNLLACGVALGALRSNYEVKGHRDVQPTLSP GDRLYEIIQTWSHYRA |
|
PDB | 7xfy Crystal structure of the ternary complex of Peptidoglycan recognition protein, PGRP-S with hexanoic and tartaric acids at 2.67 A resolution. |
Chain | C |
Resolution | 2.67 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
6NA |
C |
A92 H93 G95 N99 |
A87 H88 G90 N94 |
|
|
|
|