Structure of PDB 7xam Chain C

Receptor sequence

>7xamC (length=275) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence]

GIRKYKPTTPGRRGASVSDFAEITRSTPEKSLVRPLHGKGGRNAHGRITT
RHKGGGHKRAYRVIDFRRHDKDGVNAKVAHIEYDPNRTANIALLHYLDGE
KRYIIAPQGLKQGDVIESGANADIKPGNNLPLRNIPAGTVIHAVELRPGG
GAKLARSAGVSIQLLGKEGTYAALRMPSGEIRRVDVRCRATVGEVGNAEQ
SNINWGKAGRMRWKGKRPTVRGVVMNPVDHPHGGGEGKTSGGRHPVSPWG
KPEGRTRKPNKPSDKLIVRRRRTGK

3D structure

PDB

7xam Cryo-EM structures reveal a unique conformational dynamics of the Mycobacterium 23S rRNA helices

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	C	R4 K7 P8 T10 R13 R14 F21 K31 P36 H38 G39 K40 G42 R43 N44 H46 G47 R48 I49 T50 T51 K54 G56 H58 K59 R60 A61 Y62 R63 R68 Y84 P86 R88 D99 G100 K102 R148 G150 K154 L155 A156 R157 S158 A159 G160 R176 M177 P178 S179 E181 R183 A199 S202 N205 W206 G207 K208 A209 G210 R211 W214 R218 P219 T220 V221 R222 G223 V224 V225 M226 V229 D230 H231 H233 G234 E237 P246 P249 W250 T257 R258 K259 N261 S264 K266 R270 R272 K276	R3 K6 P7 T9 R12 R13 F20 K30 P35 H37 G38 K39 G41 R42 N43 H45 G46 R47 I48 T49 T50 K53 G55 H57 K58 R59 A60 Y61 R62 R67 Y83 P85 R87 D98 G99 K101 R147 G149 K153 L154 A155 R156 S157 A158 G159 R175 M176 P177 S178 E180 R182 A198 S201 N204 W205 G206 K207 A208 G209 R210 W213 R217 P218 T219 V220 R221 G222 V223 V224 M225 V228 D229 H230 H232 G233 E236 P245 P248 W249 T256 R257 K258 N260 S263 K265 R269 R271 K275
BS02	MG	C	D85 R88	D84 R87
BS03	MG	C	P232 H233 G234 G235	P231 H232 G233 G234

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7xam, PDBe:7xam, PDBj:7xam
PDBsum	7xam
PubMed	37709237
UniProt	A0QSD4\|RL2_MYCS2 Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]