Structure of PDB 7x1n Chain C

Receptor sequence
>7x1nC (length=92) Species: 9606 (Homo sapiens) [Search protein sequence]
GRKKIQIQRITDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNHS
NKLFQYASTDMDKVLLKYTEYNEPHESRTNADIIETLRKKGF
3D structure
PDB7x1n Functional, structural, and molecular characterizations of the leukemogenic driver MEF2D-HNRNPUL1 fusion.
ChainC
Resolution3.315 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C G2 R3 K5 K31 G1 R2 K4 K30
BS02 dna C G2 R3 T20 R24 K30 G1 R2 T19 R23 K29
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7x1n, PDBe:7x1n, PDBj:7x1n
PDBsum7x1n
PubMed35544603
UniProtQ14814|MEF2D_HUMAN Myocyte-specific enhancer factor 2D (Gene Name=MEF2D)

[Back to BioLiP]