Structure of PDB 7wnh Chain C

Receptor sequence

>7wnhC (length=313) Species: 9606 (Homo sapiens)

LCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRR
RNRCQYCRFQKCLAVGMVKEVVRTDSLKGRRGRLPSPPVSLISALVRAHV
DSNPAMTSLDYSRFQANPDTQHIQQFYDLLTGSMEIIRGWAEKIPGFADL
PKADQDLLFESAFLELFVLRLAYRSNPVEGKLIFCNGVVLHRLQCVRGFG
EWIDSIVEFSSNLQNMNIDISAFSCIAALAMVTERHGLKEPKRVEELQNK
IVNCLKDHVTFNNGNYLSKLLGKLPELRTLCTQGLQRIFYLKLEDLVPPP
AIIDKLFLDTLPF

3D structure

• PDB: 7wnh Integrative analysis reveals structural basis for transcription activation of Nurr1 and Nurr1-RXR alpha heterodimer.
• Chain: C
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	C272 Q273 H274 Y275 K284 V332 V333 R334 G340 R342 G343 R344	C11 Q12 H13 Y14 K23 V71 V72 R73 G79 R81 G82 R83
BS02	dna	C	E281 R289 R312 N313 Q316 R319 R341 R342 G343 L345 P346	E20 R28 R51 N52 Q55 R58 R80 R81 G82 L84 P85
BS03	dna	C	S366 V369 R370 I500	S93 V96 R97 I220
BS04	ZN	C	C266 C283	C5 C22
BS05	ZN	C	C305 C318	C44 C57

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0004879 nuclear receptor activity
• GO:0008270 zinc ion binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:7wnh, PDBe:7wnh, PDBj:7wnh
• PDBsum: 7wnh
• PubMed: 36442107
• UniProt: P43354|NR4A2_HUMAN Nuclear receptor subfamily 4 group A member 2 (Gene Name=NR4A2)