Structure of PDB 7w6l Chain C

Receptor sequence

>7w6lC (length=158) Species: 9606 (Homo sapiens) [Search protein sequence]

PLGSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAARDIEKHTMVIEYIGT
IIRNEVANRKEKLYESQNRGVYMFRMDNDHVIDATLTGGPARYINHSCAP
NCVAEVVTFERGHKIIISSSRRIQKGEELCYDYKFDFEDDQHKIPCHCGA
VNCRKWMN

3D structure

PDB

7w6l Structural basis for product specificities of MLL family methyltransferases.

Chain

Resolution

2.26 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.1.1.364: [histone H3]-lysine(4) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	C	K4766 I4801 G4802 T4803 I4804 I4805 R4806 V4809 R4812 K4813 L4839 T4840 G4841 P4843 R4845	K13 I48 G49 T50 I51 I52 R53 V56 R59 K60 L86 T87 G88 P90 R92
BS02	peptide	C	N4811 E4814 V4824 M4826 F4827 R4828 A4857 E4858 Y4886 K4887 F4888 E4891 I4897	N58 E61 V71 M73 F74 R75 A104 E105 Y133 K134 F135 E138 I144
BS03	ZN	C	C4851 C4901 C4906	C98 C148 C153
BS04	SAH	C	I4780 Q4781 G4782 L4783 V4824 Y4825 R4845 Y4846 N4848 H4849 Y4886 C4899 H4900 M4910	I27 Q28 G29 L30 V71 Y72 R92 Y93 N95 H96 Y133 C146 H147 M157

External links

PDB	RCSB:7w6l, PDBe:7w6l, PDBj:7w6l
PDBsum	7w6l
PubMed	36108631
UniProt	Q8NEZ4\|KMT2C_HUMAN Histone-lysine N-methyltransferase 2C (Gene Name=KMT2C)

[Back to BioLiP]