Structure of PDB 7vum Chain C |
>7vumC (length=96) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] |
GVNKVILVGNVGGDPETRYMPNGNAVTNITLATSESERTEWHRVVFFGRL AEIAGEYLRKGSQVYVEGSLRTRKWQGDRYTTEIVVDINGNMQLLG |
|
PDB | 7vum A Complexed Crystal Structure of a Single-Stranded DNA-Binding Protein with Quercetin and the Structural Basis of Flavonol Inhibition Specificity. |
Chain | C |
Resolution | 2.319 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
QUE |
C |
I105 N108 |
I88 N91 |
|
|
|