Structure of PDB 7uzp Chain C

Receptor sequence
>7uzpC (length=101) Species: 9606 (Homo sapiens) [Search protein sequence]
DVMTKEEQIFLLHRAQAQCEKRLKEVLQRPAGRPCLPEWDHILCWPLGAP
GEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKF
L
3D structure
PDB7uzp Altered signaling at the PTH receptor via modified agonist contacts with the extracellular domain provides a path to prolonged agonism in vivo.
ChainC
Resolution2.29 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C K34 I38 K5 I9
BS02 peptide C M32 E35 D69 I71 Y92 D93 V113 R118 T119 W120 A121 N122 Y123 F129 M3 E6 D40 I42 Y63 D64 V84 R89 T90 W91 A92 N93 Y94 F100
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
Biological Process
GO:0007186 G protein-coupled receptor signaling pathway
Cellular Component
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uzp, PDBe:7uzp, PDBj:7uzp
PDBsum7uzp
PubMed36409914
UniProtQ03431|PTH1R_HUMAN Parathyroid hormone/parathyroid hormone-related peptide receptor (Gene Name=PTH1R)

[Back to BioLiP]