Structure of PDB 7unw Chain C

Receptor sequence

>7unwC (length=272) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]

AIVKCKPTSAGRRFVVKVVNQELHKGAPYAPLLEKKSKSGGRNNNGRITT
RHIGGGHKQHYRLVDFRRNKDGIPAIVERVEYDPNRTAHIALLKYADGER
RYIIAPKGVAAGDQLISGIGAPIKAGNSMPLRNIPVGSTVHGIELKPGKG
AQIARSAGASAQLVAREGAYVTLRLRSGEMRKVLAECRATLGEVSNSEHS
LRSLGKAGATRWRGVRPTVRGVAMNPVDHPHGGGEGRTSAGRHPVSPWGL
QTKGKKTRSNKRTDNMIVRRRK

3D structure

PDB

7unw Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation

Chain

Resolution

2.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	C	K7 P8 S10 G12 R13 R14 F15 K18 E35 K39 S40 G42 R43 N44 N45 N46 G47 R48 I49 T50 T51 R52 H53 G56 H58 K59 Q60 H61 Y62 R63 Y83 P85 R87 D98 R101 K147 G149 K150 Q153 I154 A155 R156 S157 A158 Y171 L176 R177 S178 E180 R182 H200 S201 G206 K207 A208 G209 T211 R212 W213 R217 P218 T219 V220 R221 G222 V223 M225 N226 P227 V228 D229 H230 H232 G234 G235 E236 G237 R238 T239 S240 G242 R243 H244 P245 P248 W249 T253 K254 G255 K256 K257 T258 R259 R263 T264 R271 R272 K273	K6 P7 S9 G11 R12 R13 F14 K17 E34 K38 S39 G41 R42 N43 N44 N45 G46 R47 I48 T49 T50 R51 H52 G55 H57 K58 Q59 H60 Y61 R62 Y82 P84 R86 D97 R100 K146 G148 K149 Q152 I153 A154 R155 S156 A157 Y170 L175 R176 S177 E179 R181 H199 S200 G205 K206 A207 G208 T210 R211 W212 R216 P217 T218 V219 R220 G221 V222 M224 N225 P226 V227 D228 H229 H231 G233 G234 E235 G236 R237 T238 S239 G241 R242 H243 P244 P247 W248 T252 K253 G254 K255 K256 T257 R258 R262 T263 R270 R271 K272
BS02	MG	C	M225 D229	M224 D228
BS03	MG	C	G12 R13 K207	G11 R12 K206
BS04	MG	C	G235 G237	G234 G236

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7unw, PDBe:7unw, PDBj:7unw
PDBsum	7unw
PubMed
UniProt	Q9HWD8\|RL2_PSEAE Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]