Structure of PDB 7uml Chain C

Receptor sequence
>7umlC (length=172) Species: 11277 (Vesicular stomatitis Indiana virus) [Search protein sequence]
QLRYEKFFFTVKMTVRSNRPFRTYSDVAAAVSHWDHMYIGMAGKRPFYKI
LAFLGSSNLKATPAVLADQGQPEYHAHCEGRAYLPHRMGKTPPMLNVPEH
FRRPFNIGLYKGTIELTMTIYDDESLEAAPMIWDHFNSSKFSDFREKALM
FGLIVEKKASGAWVLDSISHFK
3D structure
PDB7uml Visualizing molecular interactions that determine assembly of a bullet-shaped vesicular stomatitis virus particle.
ChainC
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C N163 G165 K168 N106 G108 K111
Gene Ontology
Molecular Function
GO:0005198 structural molecule activity
GO:0005515 protein binding
GO:0039660 structural constituent of virion
Biological Process
GO:0006915 apoptotic process
GO:0016310 phosphorylation
GO:0039522 symbiont-mediated suppression of host mRNA export from nucleus
GO:0039602 symbiont-mediated suppression of host transcription initiation from RNA polymerase II promoter
GO:0039702 viral budding via host ESCRT complex
Cellular Component
GO:0016020 membrane
GO:0019031 viral envelope
GO:0030430 host cell cytoplasm
GO:0033644 host cell membrane
GO:0033645 host cell endomembrane system
GO:0042025 host cell nucleus
GO:0044200 host cell nuclear membrane
GO:0044423 virion component
GO:0055036 virion membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uml, PDBe:7uml, PDBj:7uml
PDBsum7uml
PubMed35970826
UniProtP03519|MATRX_VSIVA Matrix protein (Gene Name=M)

[Back to BioLiP]