Structure of PDB 7u47 Chain C |
>7u47C (length=99) Species: 9606 (Homo sapiens) [Search protein sequence] |
AKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEIL ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQ |
|
PDB | 7u47 CENP-N promotes the compaction of centromeric chromatin. |
Chain | C |
Resolution | 7.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
C |
K15 R17 R29 R32 |
K2 R4 R16 R19 |
|
|
|
|