Structure of PDB 7u46 Chain C

Receptor sequence
>7u46C (length=99) Species: 9606 (Homo sapiens) [Search protein sequence]
AKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEIL
ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQ
3D structure
PDB7u46 CENP-N promotes the compaction of centromeric chromatin.
ChainC
Resolution2.68 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C K15 R17 R29 R32 K2 R4 R16 R19
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008285 negative regulation of cell population proliferation
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7u46, PDBe:7u46, PDBj:7u46
PDBsum7u46
PubMed35422519
UniProtQ93077|H2A1C_HUMAN Histone H2A type 1-C (Gene Name=H2AC6)

[Back to BioLiP]