Structure of PDB 7tz6 Chain C

Receptor sequence

>7tz6C (length=378) Species: 9913 (Bos taurus)

TNIRKSHPLMKIVNNAFIDLPAPSNISSWWNFGSLLGICLILQILTGLFL
AMHYTSDTTTAFSSVTHICRDVNYGWIIRYMHANGASMFFICLYMHVGRG
LYYGSYTFLETWNIGVILLLTVMATAFMGYVLPWGQMSFWGATVITNLLS
AIPYIGTNLVEWIWGGFSVDKATLTRFFAFHFILPFIIMAIAMVHLLFLH
ETGSNNPTGISSDVDKIPFHPYYTIKDILGALLLILALMLLVLFAPDLLG
DPDNYTPANPLNTPPHIKPEWYFLFAYAILRSIPNKLGGVLALAFSILIL
ALIPLLHTSKQRSMMFRPLSQCLFWALVADLLTLTWIGGQPVEHPYITIG
QLASVLYFLLILVLMPTAGTIENKLLKW

3D structure

• PDB: 7tz6 Structure of complex III with bound antimalarial agent CK-2-68 provides insights into selective inhibition of Plasmodium cytochrome bc 1 complexes.
• Chain: C
• Resolution: 2.88 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	Q44 G48 R80 H83 G130 Y131 L133 H182 F183 P186	Q43 G47 R79 H82 G129 Y130 L132 H181 F182 P185
BS02	HEM	C	G34 H97 R100 S106 W113 G116 H196 L200 S205 N206	G33 H96 R99 S105 W112 G115 H195 L199 S204 N205
BS03	JHB	C	W141 G142 V145 I146 I268 F274 A277 Y278	W140 G141 V144 I145 I267 F273 A276 Y277

Gene Ontology

Molecular Function

• GO:0008121 ubiquinol-cytochrome-c reductase activity
• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding
• GO:0048039 ubiquinone binding

Biological Process

• GO:0006122 mitochondrial electron transport, ubiquinol to cytochrome c
• GO:0022904 respiratory electron transport chain
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0016020 membrane
• GO:0031966 mitochondrial membrane
• GO:0045275 respiratory chain complex III

External links

• PDB: RCSB:7tz6, PDBe:7tz6, PDBj:7tz6
• PDBsum: 7tz6
• PubMed: 37236355
• UniProt: P00157|CYB_BOVIN Cytochrome b (Gene Name=MT-CYB)