Structure of PDB 7te8 Chain C |
>7te8C (length=119) Species: 32630 (synthetic construct) [Search protein sequence] |
EVQLQASGGGFVQPGGSLRLSCAASGSTSRQYDMGWFRQAPGKEREFVSA ISSNQDQPPYYADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCAFK QHHANGAYWGQGTQVTVSS |
|
PDB | 7te8 Defining molecular glues with a dual-nanobody cannabidiol sensor. |
Chain | C |
Resolution | 1.998 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
P0T |
C |
D34 F38 Q58 A108 |
D33 F37 Q57 A107 |
|
|
|