Structure of PDB 7taw Chain C

Receptor sequence

>7tawC (length=187) Species: 286 (Pseudomonas)

MDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDES
RSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQV
SRVQAKSNPERLRRRLMRRHDLSEEEARKRIPDTVARALDLPFVTLRSQS
TGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF

3D structure

• PDB: 7taw Structural basis of AcrIF24 as an anti-CRISPR protein and transcriptional suppressor.
• Chain: C
• Resolution: 2.7 Å

Enzymatic activity

• Enzyme Commision number: 3.1.-.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	P16 A18 Q19 L54 R102 Q104 N108 E110 R111 L112 R115 H120 R130 L139 F143 V144 T145 S148 S150 T151 Q153 H154 F155 R156 F158 C175 Y176	P16 A18 Q19 L54 R102 Q104 N108 E110 R111 L112 R115 H120 R130 L139 F143 V144 T145 S148 S150 T151 Q153 H154 F155 R156 F158 C175 Y176

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004519 endonuclease activity
• GO:0005515 protein binding

Biological Process

• GO:0043571 maintenance of CRISPR repeat elements
• GO:0051607 defense response to virus

External links

• PDB: RCSB:7taw, PDBe:7taw, PDBj:7taw
• PDBsum: 7taw
• PubMed: 36163386
• UniProt: Q02MM2|CAS6_PSEAB CRISPR-associated endonuclease Cas6/Csy4 (Gene Name=cas6f)