Structure of PDB 7t8s Chain C

Receptor sequence

>7t8sC (length=164) Species: 233184 (Cryptomonas pyrenoidifera) [Search protein sequence]

AKAAYVGGADLQALKKFISEGNKRLDAVNSIVSNASCIVSDAVSGMICEN
PSLISPSGNCYTNRRMAACLRDGEIILRYVSYALLSGDSSVLEDRCLNGL
KETYSSLGVPANSNARAVSIMKACAVAFVNNTASQRKLSTPQGDCSALAS
EVAGYFDKVSAAIG

3D structure

PDB

7t8s Molecular structures reveal the origin of spectral variation in cryptophyte light harvesting antenna proteins.

Chain

Resolution

2.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	KP9	C	P65 S66 I68	P51 S52 I54
BS02	PEB	C	M60 N73 C74 R78 A82 C83 R85 D86 I89 L114 L121 V123 P124 S127 N128	M46 N59 C60 R64 A68 C69 R71 D72 I75 L100 L107 V109 P110 S113 N114
BS03	KPX	C	L25 K29 N36 K37 L39 D40 V143 P155 Q156 G157 C159	L11 K15 N22 K23 L25 D26 V129 P141 Q142 G143 C145
BS04	KQ6	C	C51 D55 S58 G59 C62 R130 I134 A137 C138 A141 F142	C37 D41 S44 G45 C48 R116 I120 A123 C124 A127 F128

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009536	plastid
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7t8s, PDBe:7t8s, PDBj:7t8s
PDBsum	7t8s
PubMed	36721353
UniProt	A0A222AH92

[Back to BioLiP]