Structure of PDB 7t7l Chain C

Receptor sequence

>7t7lC (length=266) Species: 9606 (Homo sapiens)

TEKIICRDVARGYENVPIPCVNGVDGEPCPEDYKYISENCETSTMNIDRN
ITHLQHCTCVDDCSSSNCLCGQLSIRCWYDKDGRLLQEFNKIEPPLIFEC
NQACSCWRNCKNRVVQSGIKVRLQLYRTAKMGWGVRALQTIPQGTFICEY
VGELISDAEADVREDDSYLFDLDNGEVYCIDARYYGNISRFINHLCDPNI
IPVRVFMLHQDLRFPRIAFFSSRDIRTGEELGFDYGDRFWDIKSKYFTCQ
CGSEKCKHSAEAIALE

3D structure

• PDB: 7t7l Discovery of the First-in-Class G9a/GLP Covalent Inhibitors.
• Chain: C
• Resolution: 2.2 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.-
  2.1.1.367: [histone H3]-lysine(9) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	C	C980 C1017 C1023 C1027	C63 C100 C106 C110
BS02	ZN	C	C974 C987 C1017 C1021	C57 C70 C100 C104
BS03	ZN	C	C974 C976 C980 C985	C57 C59 C63 C68
BS04	ZN	C	C1168 C1170 C1175	C249 C251 C256
BS05	SAM	C	M1048 W1050 S1084 Y1085 R1109 F1110 N1112 H1113 Y1154 F1166 C1168 Q1169	M131 W133 S167 Y168 R190 F191 N193 H194 Y235 F247 C249 Q250
BS06	G4R	C	Y1067 D1074 D1083 L1086 D1088 C1098 Y1154 R1157 F1158 I1161	Y150 D157 D166 L169 D171 C179 Y235 R238 F239 I242

Gene Ontology

Molecular Function

• GO:0002039 p53 binding
• GO:0008270 zinc ion binding
• GO:0016279 protein-lysine N-methyltransferase activity
• GO:0042054 histone methyltransferase activity

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:7t7l, PDBe:7t7l, PDBj:7t7l
• PDBsum: 7t7l
• PubMed: 35763668
• UniProt: Q96KQ7|EHMT2_HUMAN Histone-lysine N-methyltransferase EHMT2 (Gene Name=EHMT2)