Structure of PDB 7syp Chain C

Receptor sequence

>7sypC (length=213) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

VVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVS
LADLQNDEVAFRKFKLITEDVQGKNCLTNFHGMDLTRDKMCSMVKKWQTM
IEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMME
IMTREVQTNDLKEVVNKLIPDSIGKDIEKACQSIYPLHDVFVRKVKMLKK
PKFELGKLMELHG

3D structure

PDB

7syp Molecular architecture of 40S translation initiation complexes on the hepatitis C virus IRES.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	P24 K115 K116 W117 Q118 M120 R136 F138 R146 N148 Q149 I150 R151 Y155 Q157 Q159 Q160 R162 R165 Q202 S203 I204 Y205 K214 K216	P4 K95 K96 W97 Q98 M100 R116 F118 R126 N128 Q129 I130 R131 Y135 Q137 Q139 Q140 R142 R145 Q182 S183 I184 Y185 K194 K196
BS02	rna	C	K144 N147	K124 N127

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0030154	cell differentiation

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7syp, PDBe:7syp, PDBj:7syp
PDBsum	7syp
PubMed	35822879
UniProt	G1SS70\|RS3A_RABIT Small ribosomal subunit protein eS1 (Gene Name=RPS3A)

[Back to BioLiP]