Structure of PDB 7st9 Chain C

Receptor sequence
>7st9C (length=325) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SKENLPWVEKYRPETLDEVYGQNEVITTVRKFVDEGKLPHLLFYGPPGTG
KTSTIVALAREIYGKNYSNMVLELNASDDRGIDVVRNQIKDFASTRQIFS
KGFKLIILDEADAMTNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALL
SRCTRFRFQPLPQEAIERRIANVLVHEKLKLSPNAEKALIELSNGDMRRV
LNVLQSCKATLDNPDEDEISDDVIYECCGAPRPSDLKAVLKSILEDDWGT
AHYTLNKVRSAKGLALIDLIEGIVKILEDYELQNEETRVHLLTKLADIEY
SISKGGNDQIQGSAVIGAIKASFEN
3D structure
PDB7st9 Mechanisms of loading and release of the 9-1-1 checkpoint clamp.
ChainC
Resolution2.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C G89 I90 R94 G81 I82 R86
BS02 AGS C R131 R160 R123 R152
BS03 GLU C L290 Q291 F331 N333 L282 Q283 F323 N325
BS04 AGS C V16 Y19 R20 P21 Y28 P55 G56 T57 G58 K59 T60 S61 N148 M205 R206 V8 Y11 R12 P13 Y20 P47 G48 T49 G50 K51 T52 S53 N140 M197 R198
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003689 DNA clamp loader activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0016887 ATP hydrolysis activity
Biological Process
GO:0000077 DNA damage checkpoint signaling
GO:0006260 DNA replication
GO:0006261 DNA-templated DNA replication
GO:0006271 DNA strand elongation involved in DNA replication
GO:0006272 leading strand elongation
GO:0006281 DNA repair
GO:0006298 mismatch repair
GO:0007064 mitotic sister chromatid cohesion
GO:0090618 DNA clamp unloading
Cellular Component
GO:0005634 nucleus
GO:0005663 DNA replication factor C complex
GO:0005829 cytosol
GO:0031389 Rad17 RFC-like complex
GO:0031390 Ctf18 RFC-like complex
GO:0031391 Elg1 RFC-like complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7st9, PDBe:7st9, PDBj:7st9
PDBsum7st9
PubMed35314831
UniProtP38629|RFC3_YEAST Replication factor C subunit 3 (Gene Name=RFC3)

[Back to BioLiP]