Structure of PDB 7sd0 Chain C

Receptor sequence
>7sd0C (length=292) Species: 9606 (Homo sapiens) [Search protein sequence]
LNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELE
APLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICL
LLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCF
NCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLW
SDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYE
FFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKP
3D structure
PDB7sd0 Structural basis for SHOC2 modulation of RAS signalling.
ChainC
Resolution2.95 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.3.16: protein-serine/threonine phosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN C D92 N124 H173 H248 D86 N118 H167 H242
BS02 MN C D64 H66 D92 H248 D58 H60 D86 H242
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0004721 phosphoprotein phosphatase activity
GO:0004722 protein serine/threonine phosphatase activity
GO:0005515 protein binding
GO:0005521 lamin binding
GO:0008157 protein phosphatase 1 binding
GO:0016787 hydrolase activity
GO:0016791 phosphatase activity
GO:0017018 myosin phosphatase activity
GO:0019901 protein kinase binding
GO:0019903 protein phosphatase binding
GO:0019904 protein domain specific binding
GO:0044877 protein-containing complex binding
GO:0046872 metal ion binding
Biological Process
GO:0000070 mitotic sister chromatid segregation
GO:0000165 MAPK cascade
GO:0001824 blastocyst development
GO:0005977 glycogen metabolic process
GO:0006470 protein dephosphorylation
GO:0007283 spermatogenesis
GO:0030182 neuron differentiation
GO:0032922 circadian regulation of gene expression
GO:0042752 regulation of circadian rhythm
GO:0043153 entrainment of circadian clock by photoperiod
GO:0046822 regulation of nucleocytoplasmic transport
GO:0048511 rhythmic process
GO:0051301 cell division
GO:0060252 positive regulation of glial cell proliferation
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005741 mitochondrial outer membrane
GO:0005815 microtubule organizing center
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005925 focal adhesion
GO:0016607 nuclear speck
GO:0030496 midbody
GO:0032154 cleavage furrow
GO:0032991 protein-containing complex
GO:0043197 dendritic spine
GO:0072357 PTW/PP1 phosphatase complex
GO:0098793 presynapse
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7sd0, PDBe:7sd0, PDBj:7sd0
PDBsum7sd0
PubMed35768504
UniProtP36873|PP1G_HUMAN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit (Gene Name=PPP1CC)

[Back to BioLiP]