Structure of PDB 7sb6 Chain C

Receptor sequence
>7sb6C (length=203) Species: 32630 (synthetic construct) [Search protein sequence]
NRLPYFINYFFDTYLLISEDTPVGSSVTQLLARDMDNDPLVFGVSGEEAS
RFFAVESETGVVWLRQPLDRETKSEFTVEFSVSDSQGVITRKVNIQVGDV
NDNAPRFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPS
HFFAIDSGRGIVTVIRELDYEVTQAYQLQVNATDQDKTKPLSTLANLAIT
ITD
3D structure
PDB7sb6 Interpreting the Evolutionary Echoes of a Protein Complex Essential for Inner-Ear Mechanosensation.
ChainC
Resolution2.588 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 CA C E19 D69 E71 D102 E19 D69 E71 D102
BS02 CA C E19 E71 D99 V100 D102 D135 E19 E71 D99 V100 D102 D135
BS03 CA C N101 N103 D133 D135 G139 D184 N101 N103 D133 D135 G139 D184
BS04 CA C N1 R2 D34 D36 D38 D84 N1 R2 D34 D36 D38 D84
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Fri Nov 15 23:50:39 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7sb6', asym_id = 'C', title = 'Interpreting the Evolutionary Echoes of a Protein Complex Essential for Inner-Ear Mechanosensation.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7sb6', asym_id='C', title='Interpreting the Evolutionary Echoes of a Protein Complex Essential for Inner-Ear Mechanosensation.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0005509,0005886,0007155,0007156,0016020,0098609', uniprot = '', pdbid = '7sb6', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0005509,0005886,0007155,0007156,0016020,0098609', uniprot='', pdbid='7sb6', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>