Structure of PDB 7sae Chain C

Receptor sequence

>7saeC (length=267) Species: 1423 (Bacillus subtilis)

AIKKYKPTSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNNQGKLTV
RHQGGGHKRQYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEK
RYILAPKGIQVGTEIMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKG
GQLVRSAGTSAQVLGKEGKYVLVRLNSGEVRMILSACRASIGQVGNEQHE
LINIGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGKSPMSPWGKPTLGFKT
RKKKNKSDKFIVRRRKN

3D structure

• PDB: 7sae RbgA ensures the correct timing in the maturation of the 50S subunits functional sites.
• Chain: C
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	P8 N11 R13 R14 F21 K31 K39 K40 R43 N44 N45 Q46 G47 K48 L49 T50 V51 R52 Q54 G56 H58 K59 R60 Y62 R63 I74 Y83 R87 D98 G99 K147 K150 Q153 L154 V155 R156 S157 A158 G159 L176 N177 S178 E180 R182 H200 E201 I205 G206 K207 A208 G209 R210 R212 W213 R217 P218 T219 V220 R221 S223 V224 M225 N226 N228 P249 K252 T254 L255 F257 T259 R260 S266 K268 R274	P7 N10 R12 R13 F20 K30 K38 K39 R42 N43 N44 Q45 G46 K47 L48 T49 V50 R51 Q53 G55 H57 K58 R59 Y61 R62 I73 Y82 R86 D97 G98 K146 K149 Q152 L153 V154 R155 S156 A157 G158 L175 N176 S177 E179 R181 H199 E200 I204 G205 K206 A207 G208 R209 R211 W212 R216 P217 T218 V219 R220 S222 V223 M224 N225 N227 P240 K243 T245 L246 F248 T250 R251 S257 K259 R265

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0016740 transferase activity
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7sae, PDBe:7sae, PDBj:7sae
• PDBsum: 7sae
• PubMed: 35141754
• UniProt: P42919|RL2_BACSU Large ribosomal subunit protein uL2 (Gene Name=rplB)