Structure of PDB 7s5k Chain C |
>7s5kC (length=68) Species: 34 (Myxococcus xanthus) [Search protein sequence] |
DLDDVARIRLVLARELETINEYEAYARASSNPEVRAFFQHLAAEEKEHVS EAVHMLRMLDSGQNDHFA |
|
PDB | 7s5k Structural characterization of the Myxococcus xanthus encapsulin and ferritin-like cargo system gives insight into its iron storage mechanism. |
Chain | C |
Resolution | 1.95 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
FE |
C |
H61 E64 |
H48 E51 |
|
BS02 |
FE |
C |
E28 E58 |
E15 E45 |
|
|
|