Structure of PDB 7rte Chain C

Receptor sequence

>7rteC (length=420) Species: 10090 (Mus musculus)

SPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYL
MGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTA
KTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLK
NADLCIASGTKVALFNRLRSQTVSTRYLHVEGGNFHASSQQWGAFYIHLL
DDDESEGEEFTVRDGYIHYGQTVKLVCSVTGMALPRLIIRKVDKQTALLD
ADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCPKEQNKEMINDG
ASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNDVAMLELTGQNF
TPNLRVWFGDVEAETMYRCGESMLCVVPDISAFREGWRWVRQPVQVPVTL
VRNDGVIYSTSLTFTYTPEP

3D structure

• PDB: 7rte The structure, binding and function of a Notch transcription complex involving RBPJ and the epigenetic reader protein L3MBTL3.
• Chain: C
• Resolution: 2.06 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	K84 Y86 S191 K192 S194 K196 R220 Q222 V224	K33 Y35 S140 K141 S143 K145 R169 Q171 V173
BS02	dna	C	K90 R91 F92 K192 R218 S221 T223	K39 R40 F41 K141 R167 S170 T172
BS03	peptide	C	N235 F236 E259 E260 F261 V263 G282 M283 A284 P286 I331 I332 Q333 F334	N184 F185 E208 E209 F210 V212 G231 M232 A233 P235 I280 I281 Q282 F283

Gene Ontology

Molecular Function

• GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
• GO:0001228 DNA-binding transcription activator activity, RNA polymerase II-specific
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity

Biological Process

• GO:0006355 regulation of DNA-templated transcription
• GO:0006357 regulation of transcription by RNA polymerase II

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:7rte, PDBe:7rte, PDBj:7rte
• PDBsum: 7rte
• PubMed: 36477367
• UniProt: P31266|SUH_MOUSE Recombining binding protein suppressor of hairless (Gene Name=Rbpj)