Structure of PDB 7r5r Chain C

Receptor sequence
>7r5rC (length=98) Species: 9606 (Homo sapiens) [Search protein sequence]
AKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEIL
ELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNI
3D structure
PDB7r5r Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
ChainC
Resolution2.44 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C R17 R20 R32 R4 R7 R19
BS02 dna C R42 V43 A45 T76 R77 R29 V30 A32 T63 R64
BS03 peptide C E61 E64 D90 E91 E92 E48 E51 D77 E78 E79
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0008285 negative regulation of cell population proliferation
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r5r, PDBe:7r5r, PDBj:7r5r
PDBsum7r5r
PubMed35420891
UniProtQ93077|H2A1C_HUMAN Histone H2A type 1-C (Gene Name=H2AC6)

[Back to BioLiP]