Structure of PDB 7r5i Chain C |
>7r5iC (length=148) Species: 1396 (Bacillus cereus) [Search protein sequence] |
TLPAFGFAFNASAPQFASLFTPLLLPSVSPNPNITVPVINDTVSVGDGIR ILRAGIYQISYTLTISLDNVPTAPEAGRFFLSLNTPANIIPGSGTAVRST GEVDVSSGVILINLNPGDLIQIVPVELIGTVDIRAAALTVAQISRPHH |
|
PDB | 7r5i Crystal structure of ExsFA, a Bacillus cereus spore exosporium protein" |
Chain | C |
Resolution | 1.08 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
C |
S131 S132 |
S106 S107 |
|
|
|
|