Structure of PDB 7r32 Chain C

Receptor sequence
>7r32C (length=92) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
AKPANKLVIVTEKILLKKIAKIIDESGAKGYTVMNTGGKGSRNVRIEANI
KFEILTETREMAEEIADRVAVKYFNDYAGIIYICSAEVLYGH
3D structure
PDB7r32 Carbon signaling protein SbtB possesses atypical redox-regulated apyrase activity to facilitate regulation of bicarbonate transporter SbtA.
ChainC
Resolution1.75 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP C G31 Y32 T33 L65 H102 G30 Y31 T32 L55 H92
BS02 ADP C G39 K40 G41 S42 R43 R46 N59 A88 G89 I90 G38 K39 G40 S41 R42 R45 N49 A78 G79 I80
Gene Ontology
Molecular Function
GO:0030234 enzyme regulator activity
Biological Process
GO:0006808 regulation of nitrogen utilization
Cellular Component
GO:0005886 plasma membrane
GO:0009579 thylakoid
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r32, PDBe:7r32, PDBj:7r32
PDBsum7r32
PubMed36800386
UniProtP73954|Y1513_SYNY3 Membrane-associated protein slr1513 (Gene Name=slr1513)

[Back to BioLiP]