Structure of PDB 7r31 Chain C

Receptor sequence
>7r31C (length=105) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
KPANKLVIVTEKILLKKIAKIIDESGAKGYTVMNTGGKGSRNVRSSIEAN
IKFEILTETREMAEEIADRVAVKYFNDYAGIIYICSAEVLYGHTFAGPEG
ASAWS
3D structure
PDB7r31 Carbon signaling protein SbtB possesses atypical redox-regulated apyrase activity to facilitate regulation of bicarbonate transporter SbtA.
ChainC
Resolution1.52 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ATP C G31 Y32 T33 L65 G29 Y30 T31 L56
BS02 ATP C V11 G39 K40 G41 S42 R43 N44 V45 R46 S47 N59 A88 G89 I90 V9 G37 K38 G39 S40 R41 N42 V43 R44 S45 N50 A79 G80 I81
Gene Ontology
Molecular Function
GO:0030234 enzyme regulator activity
Biological Process
GO:0006808 regulation of nitrogen utilization
Cellular Component
GO:0005886 plasma membrane
GO:0009579 thylakoid
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r31, PDBe:7r31, PDBj:7r31
PDBsum7r31
PubMed36800386
UniProtP73954|Y1513_SYNY3 Membrane-associated protein slr1513 (Gene Name=slr1513)

[Back to BioLiP]