Structure of PDB 7r2z Chain C

Receptor sequence
>7r2zC (length=99) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
AKPANKLVIVTEKILLKKIAKIIDESGAKGYTVMNTGGKGIEANIKFEIL
TETREMAEEIADRVAVKYFNDYAGIIYICSAEVLYGHTFCGPEGCSAWS
3D structure
PDB7r2z Carbon signaling protein SbtB possesses atypical redox-regulated apyrase activity to facilitate regulation of bicarbonate transporter SbtA.
ChainC
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP C G31 Y32 T33 E63 I64 L65 T103 G30 Y31 T32 E48 I49 L50 T88
BS02 ATP C V11 G39 K40 G41 E57 N59 A88 G89 I90 V10 G38 K39 G40 E42 N44 A73 G74 I75
Gene Ontology
Molecular Function
GO:0030234 enzyme regulator activity
Biological Process
GO:0006808 regulation of nitrogen utilization
Cellular Component
GO:0005886 plasma membrane
GO:0009579 thylakoid
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r2z, PDBe:7r2z, PDBj:7r2z
PDBsum7r2z
PubMed36800386
UniProtP73954|Y1513_SYNY3 Membrane-associated protein slr1513 (Gene Name=slr1513)

[Back to BioLiP]