Structure of PDB 7qwr Chain C

Receptor sequence

>7qwrC (length=362) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

ACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQP
YAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRM
FAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELP
LVVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRR
IQRRGPCVIYNEDNGIVKAFRNIPGITLLNVTKLNILKLAPGGHVGRFCI
WTESAFRKLDDLYGTWRKAASLKSNYNLPMHKMLNTDLSRILKSPEIQRA
LRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRV
ERAAAALAAKSD

3D structure

PDB

7qwr Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	R33 N38 F39 T42 N43 R45 N47 N48 R49 Q50 Y52 V54 S55 E56 A58 H60 Q61 T62 S63 T69 G70 R71 V73 A74 R75 P77 R80 G83 T84 R86 Q89 N94 M95 R97 G98 R100 M101 F102 A103 P104 K106 R110 R114 N116 T118 Q119 K120 R121 K140 K163 T164 K165 K172 W177 K181 K182 Y184 R188 M189 R190 A191 G192 K193 K195 R197 R199 R201 R204 R205 K219 R222 N223 K234 L235 N236 K239 P242 G243 H245 R268 K274 S275 R291 L293 R300 P305 R306 K307 K308 I309 H310 R311 R312 L314 K316 N317 K320 N321 L322 R323 L326 K327 K333 M335 T339 I340 Q343 N346 H347 R350	R32 N37 F38 T41 N42 R44 N46 N47 R48 Q49 Y51 V53 S54 E55 A57 H59 Q60 T61 S62 T68 G69 R70 V72 A73 R74 P76 R79 G82 T83 R85 Q88 N93 M94 R96 G97 R99 M100 F101 A102 P103 K105 R109 R113 N115 T117 Q118 K119 R120 K139 K162 T163 K164 K171 W176 K180 K181 Y183 R187 M188 R189 A190 G191 K192 K194 R196 R198 R200 R203 R204 K218 R221 N222 K233 L234 N235 K238 P241 G242 H244 R267 K273 S274 R290 L292 R299 P304 R305 K306 K307 I308 H309 R310 R311 L313 K315 N316 K319 N320 L321 R322 L325 K326 K332 M334 T338 I339 Q342 N345 H346 R349
BS02	rna	C	A53 V54 S55 K193 K195 M196	A52 V53 S54 K192 K194 M195

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7qwr, PDBe:7qwr, PDBj:7qwr
PDBsum	7qwr
PubMed	35201867
UniProt	G1SVW5\|RL4_RABIT Large ribosomal subunit protein uL4 (Gene Name=RPL4)

[Back to BioLiP]