Structure of PDB 7qv2 Chain C

Receptor sequence

>7qv2C (length=272) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]

AIKKYKPTSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNNQGKLTV
RHQGGGHKRQYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEK
RYILAPKGIQVGTEIMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKG
GQLVRSAGTSAQVLGKEGKYVLVRLNSGEVRMILSACRASIGQVGNEQHE
LINIGKAGRSRWKGIRPTVRGSVMNPNDHPHGGGEGRAPIGRKSPMSPWG
KPTLGFKTRKKKNKSDKFIVRR

3D structure

PDB

7qv2 Bacterial ribosome collision sensing by a MutS DNA repair ATPase paralogue.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	K7 P8 S10 N11 G12 R13 R14 F21 K31 H38 K39 K40 R43 N44 N45 Q46 G47 K48 L49 T50 V51 R52 H53 Q54 H58 K59 R60 Q61 Y62 R63 Y83 P85 R87 A97 D98 G99 E100 K101 K147 G149 K150 Q153 L154 V155 R156 S157 A158 G159 K170 Y171 L176 N177 E180 R182 H200 E201 N204 I205 G206 K207 A208 G209 R210 S211 R212 W213 R217 P218 T219 V220 R221 S223 V224 M225 N226 N228 D229 H230 H232 G234 G235 E236 G237 R238 P240 I241 R243 K244 P246 K252 T254 G256 K258 T259 R260 K263 S266	K6 P7 S9 N10 G11 R12 R13 F20 K30 H37 K38 K39 R42 N43 N44 Q45 G46 K47 L48 T49 V50 R51 H52 Q53 H57 K58 R59 Q60 Y61 R62 Y82 P84 R86 A96 D97 G98 E99 K100 K146 G148 K149 Q152 L153 V154 R155 S156 A157 G158 K169 Y170 L175 N176 E179 R181 H199 E200 N203 I204 G205 K206 A207 G208 R209 S210 R211 W212 R216 P217 T218 V219 R220 S222 V223 M224 N225 N227 D228 H229 H231 G233 G234 E235 G236 R237 P239 I240 R242 K243 P245 K251 T253 G255 K257 T258 R259 K262 S265
BS02	rna	C	Q163 E168 L202 R272	Q162 E167 L201 R271

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7qv2, PDBe:7qv2, PDBj:7qv2
PDBsum	7qv2
PubMed	35264791
UniProt	P42919\|RL2_BACSU Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]