Structure of PDB 7q3o Chain C

Receptor sequence
>7q3oC (length=63) Species: 9606 (Homo sapiens) [Search protein sequence]
TRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKSELAANLGLTERQVKI
WFQNRRAKERKVN
3D structure
PDB7q3o Structure of CDX1 bound to hydroxymethylated DNA
ChainC
Resolution2.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C T183 R184 T185 R190 V191 Y193 R198 R228 Q229 I232 N236 K240 T1 R2 T3 R8 V9 Y11 R16 R46 Q47 I50 N54 K58
BS02 dna C Y189 R190 V192 I213 K216 Q235 R238 R242 Y7 R8 V10 I31 K34 Q53 R56 R60
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:7q3o, PDBe:7q3o, PDBj:7q3o
PDBsum7q3o
PubMed
UniProtP47902|CDX1_HUMAN Homeobox protein CDX-1 (Gene Name=CDX1)

[Back to BioLiP]