Structure of PDB 7q2z Chain C |
>7q2zC (length=90) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
EKDLMAYFDENLNRNWRGREHWKVLEIDFFKTDDSFEDKVFASKGRTKID MPIKNRKNDTHYLLPDDFHFSTDRITRLFIKPGQKMSLFS |
|
PDB | 7q2z Clamping of DNA shuts the condensin neck gate. |
Chain | C |
Resolution | 3.2 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
C |
T481 K482 |
T47 K48 |
|
|
|
|