Structure of PDB 7pzk Chain C

Receptor sequence
>7pzkC (length=143) Species: 490133 (Hepatitis B virus ayw/France/Tiollais/1979) [Search protein sequence]
MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTL
3D structure
PDB7pzk Binding of a Pocket Factor to Hepatitis B Virus Capsids Changes the Rotamer Conformation of Phenylalanine 97.
ChainC
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 TRT C V13 N92 L95 K96 F97 L100 V13 N92 L95 K96 F97 L100
BS02 TRT C L60 C61 L60 C61
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0005198 structural molecule activity
Biological Process
GO:0046718 symbiont entry into host cell
GO:0075521 microtubule-dependent intracellular transport of viral material towards nucleus
GO:0075732 viral penetration into host nucleus
Cellular Component
GO:0030430 host cell cytoplasm
GO:0039619 T=4 icosahedral viral capsid
GO:0043657 host cell

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pzk, PDBe:7pzk, PDBj:7pzk
PDBsum7pzk
PubMed34834922
UniProtP03146|CAPSD_HBVD3 Capsid protein (Gene Name=C)

[Back to BioLiP]